PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv7_159570_afnu.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 451aa    MW: 49190.8 Da    PI: 8.342
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv7_159570_afnu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.71.1e-12365417557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +  +L +eN +Lk+ l e++ + +
  Bv7_159570_afnu.t1 365 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLREENAQLKQALAEIERQRK 417
                         79****************************************99999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-12361426IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.737363415IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.94E-10365415No hitNo description
Gene3DG3DSA:1.20.5.1705.9E-13365418No hitNo description
PfamPF001708.3E-11365417IPR004827Basic-leucine zipper domain
CDDcd147075.77E-23365421No hitNo description
PROSITE patternPS000360368383IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MVAAESEMMV QPEVNSPAMT ATIDPHHNPK SSNHIDHNSN HRNGSEPNNY VFPSLGRQSS  60
IYSLTLDEFQ HTLSESGKNF GSMNMDEFLN SIWTAEENQA HHSHHHENPS NIQLPSVNIA  120
AAATSRGAGA ITKQPSLPRQ GSLTLPAPLC RKTVDEVWTE IQRSHQPEDD QQQNQQQQIE  180
TTSSAQRQAT FGEMTLEDFL IKAGVVREQC GTAPQTPLAA VAPAPPPTQH PPHHQYGFST  240
APQMGPTFVT RPMIGMAPGG AYQPMPPSAG ESSGYTGNGK RNNGYPAPVV GPSVACYGGR  300
MNNGGAPGGG FAPGPGLSPV SPVSPEGMCG PGQVDNPGGQ YGLDMGALRG RKRIIDGPVE  360
KVVERRQRRM IKNRESAARS RARKQAYTVE LEAELNQLRE ENAQLKQALA EIERQRKQQY  420
REEQNIQVIL SRAQRAQDKL RAMRRSRSST L
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683741.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like
SwissprotQ9SJN01e-102ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0J8C3G40.0A0A0J8C3G4_BETVU; Uncharacterized protein
STRINGSolyc09g009490.2.11e-132(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.12e-87bZIP family protein